Common Tasks With P3 Scripts
Here we present examples of common tasks and show how to accomplish them with the command-line interface
Working with Taxonomic Groupings
List Roles that are Found in One Species but not Another
For our example, we will compare Vibrio campbellii with Vibrio alginolyticus.
To answer this question, we need a file of roles from Vibrio alginolyticus and use it to filter out roles from Vibrio campbellii. The following pipe gets all the roles from Vibrio alginolyticus genomes and puts them in the file aRoles.tbl.
p3-all-genomes --eq "genome_name,Vibrio alginolyticus" | p3-get-genome-features --attr product | p3-function-to-role | p3-sort --count feature.role >aRoles.tbl
There are a lot of pieces to this pipe. First, p3-all-genomes
gets all the genome IDs for Vibrio alginolyticus. Then
p3-get-genome-features finds all the features for those genomes
and outputs the functional assignment (product).
p3-function-to-role converts the functions to roles and
eliminates the hypotheticals. Finally, p3-sort with the
--count option counts the number of occurrences of each role. It
takes a while, but the output looks something like this.
feature.role count (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) 34 (3R)-hydroxymyristoyl-[ACP] dehydratase (EC 4.2.1.-) 34 1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC 2.4.1.18) 37 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) 34 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) 34 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis 34 1,6-anhydro-N-acetylmuramyl-L-alanine amidase 35 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267) 34 1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7) 35 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1) 38 1-phosphofructokinase (EC 2.7.1.56) 34
Now we perform the same exercise with Vibrio campbellii.
p3-all-genomes --eq "genome_name,Vibrio campbellii" | p3-get-genome-features --attr product | p3-function-to-role | p3-sort --count feature.role >cRoles.tblfeature.role count (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) 25 1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC 2.4.1.18) 27 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) 25 1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74) 27 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis 28 1,6-anhydro-N-acetylmuramyl-L-alanine amidase 25 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267) 30 1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7) 27 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1) 26 1-phosphofructokinase (EC 2.7.1.56) 33 16 kDa heat shock protein A 25
Now we filter cRoles.tbl by removing records that match aRoles.tbl. Note that we are matching on the key column ONLY. We don’t care about the counts, only which roles are in campbellii but not alginolyticus. The p3-file-filter command performs this task.
p3-file-filter --reverse --col=feature.role aRoles.tbl <cRoles.tbl
The --reverse option tells us we want roles that are in the
standard input file (cRoles.tbl) but not the filter file
(aRoles.tbl). The --col option tells us we are comparing
values in the feature.role column. Both files are the same format;
if the formats were different, we could specify a different key
column identifier for the filter file by appending it as a
positional parameter. So, another way to code the same thing would
be
p3-file-filter --reverse --col=feature.role aRoles.tbl feature.role <cRoles.tbl
The output looks something like this
feature.role count 2,3-dihydroxybenzoate-AMP ligase (EC 2.7.7.58) of siderophore biosynthesis 33 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-) 1 2-pyrone-4,6-dicarboxylic acid hydrolase (EC 3.1.1.57) 14 23S ribosomal RNA rRNA prediction is too short 1 3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-) 1 4-amino-4-deoxy-L-arabinose transferase 26 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase 17 4-carboxy-4-hydroxy-2-oxoadipate aldolase (EC 4.1.3.17) 16 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) 7 4-oxalmesaconate hydratase (EC 4.2.1.83) 14 4-oxalocrotonate tautomerase 1
Compute How Many Genomes we have in a Particular Genus
For Streptococcus:
p3-all-genomes --equal genus,Streptococcus --countgenome.count 11836
Note the use of the --count command-line option to produce a
count of the results instead of the results themselves.
List the Genomes we have in a Particular Genus
For Streptococcus:
p3-all-genomes --equal genus,Streptococcus --attr genome_namegenome.genome_id genome.genome_name 1302.21 Streptococcus gordonii strain DD07 1303.76 Streptococcus oralis strain DD05 1303.77 Streptococcus oralis strain DD14 1303.78 Streptococcus oralis strain DD15 1303.79 Streptococcus oralis strain DD16 1303.80 Streptococcus oralis strain DD20 1303.81 Streptococcus oralis strain DD21 1303.82 Streptococcus oralis strain DD27 1303.83 Streptococcus oralis strain DD30
p3-all-genomes always includes the ID, so all we need for the
--attr parameter is the name field. If you intend to pipe the
results into another script, specify the attributes in the order you
want them to appear.
p3-all-genomes --equal genus,Streptococcus --attr genome_name --attr genome_id
genome.genome_name genome.genome_id
Streptococcus gordonii strain DD07 1302.21
Streptococcus oralis strain DD05 1303.76
Streptococcus oralis strain DD14 1303.77
Streptococcus oralis strain DD15 1303.78
Streptococcus oralis strain DD16 1303.79
Streptococcus oralis strain DD20 1303.80
Streptococcus oralis strain DD21 1303.81
Streptococcus oralis strain DD27 1303.82
Streptococcus oralis strain DD30 1303.83
Compute the Fraction of the Genomes in a Genus that are Resistant to a Particular Drug
In our example, we will look for Staphylococcus genomes resistant to methicillin.
This is a two-step process, since we need two numbers– the total number of Staphylococcus genomes and the number that are methicillin-resistant.
p3-all-genomes --equal genome_name,Staphylococcus --count
We isolate the genus by doing a string match on the genome name,
since equality for string fields matches if the value is a
substring. We could also use --equal genus,Staphylococcus and
get an equivalent result.
genome.count 10716
To get the count of resistant genomes, we need to pipe the drug name into p3-get-drug-genomes. Here we don’t have the option of using the genus field, since only the genome name is present in the drug-genome records, not the entire taxonomy.
p3-echo -t antibiotic methicillin | p3-get-drug-genomes --resistant --equal genome_name,Staphylococcus --countantibiotic genome_drug.count methicillin 1064
The answer is 1064 * 100 / 10716 or 9.93%.
Working with Genomes
Find a Genome from an Accession Number or Project ID
Genomes in MAAGE are stored with four alternate IDs, any of which can be used to search for the genomes.
ncbi_project_id. The NCBI project number
refseq_project_id. The REFSEQ project number
genbank_accessions. The accession string from GENBANK
refseq_accessions. The accession string from REFSEQ
The following commands all return the genome Streptococcus mutans UA159.
p3-all-genomes --eq genbank_accessions,AE014133
p3-all-genomes --eq refseq_accessions,NC_004350
p3-all-genomes --eq ncbi_project_id,333
p3-all-genomes --eq refseq_project_id,57947
Because no attributes were specified, the output in each case is solely the genome ID, a single output record in a single column.
genome.genome_id
210007.7
Given a Genome ID, Find the Name
The genome name is in an attribute called genome_name. You can get it from the genome ID using p3-all-genomes as shown here.
p3-all-genomes --eq genome_id,210007.7 --attr genome_name
genome.genome_id genome.genome_name
210007.7 Streptococcus mutans UA159
Alternatively, you can use p3-get-genome-data and use p3-echo to pipe in the ID.
p3-echo 210007.7 | p3-get-genome-data --attr genome_name
id genome.genome_name
210007.7 Streptococcus mutans UA159
Find a Gene by Name in a Particular Genome
Here you want to use p3-find-features with a genome_id filter.
p3-echo coaA | p3-find-features --attr patric_id,product --eq genome_id,210007.7 gene
id feature.patric_id feature.product
coaA fig|210007.7.peg.1009 Pantothenate kinase (EC 2.7.1.33)
Display the CDS and RNA features for A Genome Sorted by Location on the Chromosome
For the genome 1313.7001 (Streptococcus pneumoniae P210774-233).
p3-echo -t genome_id 1313.7001 | p3-get-genome-features --in feature_type,CDS,rna --attr patric_id --attr sequence_id --attr start --attr strand --attr product | p3-sort feature.sequence_id feature.start/n feature.strand
We start by using p3-echo to create a file that has our single
genome ID in it. The bulk of the retrieval work is performed by
p3-get-genome-features. The --in parameter allows us to
specify a list of values for a specific field. In this case, we want
feature_type to equal either CDS or rna. To sort by
location, we need the contig ID (sequence_id) and the start
location (start). The start location is always the leftmost
location on the contig, so it is perfect for sorting. Finally, we
add the strand (+ or i) and then the functional assignment
(product) so we can see what the feature does. The p3-sort
gets the file records in the proper order. Because one of the fields
is numeric, we put a /n after the field name. This tells the
sorter that for the feature.start column, the value 20 comes
before, not after, the value 100. The output will look something
like this.
genome_id feature.patric_id feature.sequence_id feature.start feature.strand feature.product 1313.7001 fig|1313.7001.peg.1 1313.7001.con.0001 40 - Mobile element protein 1313.7001 fig|1313.7001.peg.2 1313.7001.con.0001 540 - Mobile element protein 1313.7001 fig|1313.7001.peg.3 1313.7001.con.0001 994 - Mobile element protein 1313.7001 fig|1313.7001.peg.4 1313.7001.con.0002 1 + Streptococcal histidine triad protein 1313.7001 fig|1313.7001.peg.5 1313.7001.con.0003 1 + Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) 1313.7001 fig|1313.7001.peg.6 1313.7001.con.0003 1120 - Fibronectin/fibrinogen-binding protein 1313.7001 fig|1313.7001.peg.7 1313.7001.con.0003 2880 + Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly 1313.7001 fig|1313.7001.peg.8 1313.7001.con.0003 3358 + Diacylglycerol kinase (EC 2.7.1.107) 1313.7001 fig|1313.7001.peg.9 1313.7001.con.0003 3770 + GTP-binding protein Era 1313.7001 fig|1313.7001.peg.10 1313.7001.con.0003 4684 + Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23) 1313.7001 fig|1313.7001.peg.11 1313.7001.con.0003 5541 + Dephospho-CoA kinase (EC 2.7.1.24) 1313.7001 fig|1313.7001.peg.12 1313.7001.con.0003 6133 + Multidrug resistance efflux pump PmrA 1313.7001 fig|1313.7001.peg.13 1313.7001.con.0003 7521 + Protein translocase membrane subunit SecG 1313.7001 fig|1313.7001.peg.14 1313.7001.con.0003 7856 + 3'-to-5' exoribonuclease RNase R 1313.7001 fig|1313.7001.peg.15 1313.7001.con.0003 10173 + tmRNA-binding protein SmpB 1313.7001 fig|1313.7001.peg.16 1313.7001.con.0003 10656 + Tellurite methyltransferase (EC 2.1.1.265)
Compute the Upstream Regions for the Protein-Encoding Genes in a Genome
For the genome 1313.7001 (Streptococcus pneumoniae P210774-233).
We get upstream regions from the p3-feature-upstream script, but to use it we need an input list of feature IDs. We will produce feature IDs and functional assignments, then append the upstream sequences.
p3-echo -t genome_id 1313.7001 | p3-get-genome-features --eq feature_type,CDS --attr patric_id --attr product | p3-feature-upstream --col=feature.patric_id
The -eq feature_type,CDS ensures we only see protein-encoding
features. Because we are not putting the feature ID in the last
column, we use --col=feature.patric_id to direct
p3-feature-upstream to the correct input column. The output will
look something like this. Note the upstream DNA is in the last
column.
genome_id feature.patric_id feature.product upstream 1313.7001 fig|1313.7001.peg.1182 beta-glycosyl hydrolase ttgtcatctcctcttgactctcgttaatataagaaataaaataagggcgttgatttatataatcgctatcaatataacaatgcaatcaggaggttttgca 1313.7001 fig|1313.7001.peg.1189 IMP cyclohydrolase (EC 3.5.4.10) / Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) gatcaatatcttaggtatgcttagccttggttttgcttatcttgttttactgttactgcatttaattggtgtttaactaatgattaaaaaggagaatata 1313.7001 fig|1313.7001.peg.1191 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) tcagccctgaaaatgtagagcgtgtaaaagaattgttggatgaagcagtctatgaaattggtcgcatcgtcaagaaagaaaacgaaagtgtcattatcaa 1313.7001 fig|1313.7001.peg.1192 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) tctctatgactacgaagaagactatcgtagaagtttggaagaaaagaccagtttttacaagtaggcgacagattctccattaaagaaaaggaaaaaacaa 1313.7001 fig|1313.7001.peg.1199 hypothetical protein aaggtggcggatgcaattggggagattttgccaaagcaggtgttggaggaggagctatacttggaggtgtggcctatgcagcgacatgttggtggtaatt 1313.7001 fig|1313.7001.peg.1211 hypothetical protein ttggcgattaccaacaatggacaggaaaaccatctggttaagatggcattcttggaattaaaaaatacagagaaaccagcaaagacaaggttcgcaagcc 1313.7001 fig|1313.7001.peg.1259 Acetyl xylan esterase 1; Cephalosporin-C deacetylase (EC 3.1.1.41) aaagaatctaaattcactttctatttacccttctttcttgcattgattacatagatatgctacagttgtggtaacgattacaaaataaaaggagcatgct 1313.7001 fig|1313.7001.peg.1278 Helicase loader DnaB acgttttgctagtgtctatcgtagttttaaggatgtcagtgagttagagagcttgctccaacaaatcacccagtcctctaaaaagaaaaaggaaagataa 1313.7001 fig|1313.7001.peg.1288 Fructokinase (EC 2.7.1.4) ttattagatagtaagatttacagaggaaaatctaaaaaatagagacatttagactttcgaagtatgctataataaagaaaataaaaacaagaggtttatc
You can use the --len parameter of p3-feature-upstream to
change the number of base pairs displayed (the default is 100). If
the feature is at the edge of the contig, you may see less than the
specified length or even nothing at all, since the script stops at
the contig boundary. To see downstream regions instead, use the
--downstream option. This pipe shows the 10 base pairs
downstream of each gene.
p3-echo -t genome_id 1313.7001 | p3-get-genome-features --eq feature_type,CDS --attr patric_id --attr product | p3-feature-upstream --col=feature.patric_id --downstream --len=10genome_id feature.patric_id feature.product downstream 1313.7001 fig|1313.7001.peg.1182 beta-glycosyl hydrolase gtcttttcga 1313.7001 fig|1313.7001.peg.1189 IMP cyclohydrolase (EC 3.5.4.10) / Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) gaagataaaa 1313.7001 fig|1313.7001.peg.1191 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) ctttttgatg 1313.7001 fig|1313.7001.peg.1192 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) aaaaaatagc 1313.7001 fig|1313.7001.peg.1199 hypothetical protein tcaaaactat 1313.7001 fig|1313.7001.peg.1211 hypothetical protein tcaactacat 1313.7001 fig|1313.7001.peg.1259 Acetyl xylan esterase 1; Cephalosporin-C deacetylase (EC 3.1.1.41) ggagtcgact 1313.7001 fig|1313.7001.peg.1278 Helicase loader DnaB atggaaagtg
Compute the Codon Usage in a Genome
Our example genome is 186497.12 (Pyrococcus furiosus DSM 3638).
The p3-sequence-profile script counts the number of occurrences of each letter in a sequence field. To use it, we need to create a file that has the sequences we want to analyze in the last column. We start with the genome ID, then use p3-get-genome-features to get the feature data. The aa_sequence field contains the protein sequences, which are then processed by p3-sequence-profile.
p3-echo -t genome_id 186497.12 | p3-get-genome-features --attr aa_sequence | p3-sequence-profile
By default, p3-sequence-profile works on the last input column, which in this case is the amino acid sequence. The output will look something like this.
letter count L 58114 E 51852 I 50270 K 46874 V 45417 G 41210 A 38057 R 30791 S 28102 F 25399 T 25375 D 25340 P 24706 Y 23048 N 19998 M 12966 Q 10045 H 8653 W 7104 C 3359
Note that the output is sorted from most common to least. The same trick works for DNA sequences, which are in the na_sequence field.
p3-echo -t genome_id 186497.12 | p3-get-genome-features --attr na_sequence | p3-sequence-profileletter count A 597286 T 465185 G 440197 C 305118
Extract a Fasta File of a Genome’s Contigs
Our example is 1302.21 (Streptococcus gordonii strain DD07).
p3-genome-fasta 1302.21>1302.21.con.0001 contig agctcagttggtagtagcgcatgactgttaatcatgatgtcgtaggttcgagtcctactg ccggagttatatctataagtaagacaagaaattcttgtctttttatatttattgtgtttt tgcaatttaatttttaagttcttatttaataaaaagcttgaagattattcttcaagcttt ttatgtttattaaagaatgcttcatagagggctttaatagctgctttttcttgttcagag tttactacgagcatgatagaaacttcgctagatccttgagagatcatttgaatattaatt ttgctgtctgatagagcctttgtagccgtagcagtcagaccgatatgacttttcatttgc
List the Protein Sequences for the Genes in a Genome
Our example is 1302.21 (Streptococcus gordonii strain DD07).
p3-genome-fasta --protein 1302.21>fig|1302.21.peg.966 putative Zn-dependent protease MRFLLNLFRFIWRMFWRLVWAGIVAFIILVSVLYLTNPSQTGLTAVRQAVQTAVNQLDTF LDQQGIHTGLGQNVQNLGEHLTDQHVASSDGARWENARATVYIETENSTFRAAYQEAIKS WNATGAFTFQLVEDKSQANIIATEMNDSTITAAGEAESQTNVLTKRFTKVTVRLNAYYLL NNYYGYSHERIVNTASHELGHAIGLDHNESESVMQSAGSFYSIQPIDIQAVKELYQD >fig|1302.21.peg.969 Putative metallopeptidase (Zinc) SprT family MNLNEYIKQVSLEDFGWEFRHQAFWNKRLRTTGGRFFPKDGHLDFNPKIYETFGLETFRK IVRHELAHYHLYYQGKGYRHKDRDFKELLKQVGGLRYAPGLPAKKLKLHYQCRSCCTDFY RQRRIEIKKYRCGRCKGKLRLLKQER
Given a List of Genomes, Produce a List of Pairs of Roles that are Implemented by Genes that are Close on the Chromosome, Sorted by Number of Occurrences
Here we assume our list of genomes is in the file genomes.tbl. The content of this file is shown below.
genome_id 1310696.14 66976.17 91890.5 316273.25 186497.12 1353158.3 135461.13 1173954.3 1176728.3
We use p3-get-genome-features to get the feature and location data, p3-function-to-role to convert the functions to roles, and p3-generate-close-roles to compute the physically close roles. Because we only want protein-encoding genes (pegs), we filter the genome features by type. (If we didn’t do this, the output would start with a whole bunch of generic roles involving ribosomes and CRISPR repeats.) The output is automatically sorted by decreasing number of occurrences.
p3-get-genome-features --eq feature_type,CDS --attr sequence_id --attr location --attr product <genomes.tbl | p3-function-to-role | p3-generate-close-rolesrole1 role2 count Transposase, IS3/IS911 family Mobile element protein 33 Mobile element protein Mobile element protein 29 Lead, cadmium, zinc and mercury transporting ATPase (EC 3.6.3.3) (EC 3.6.3.5) Copper-translocating P-type ATPase (EC 3.6.3.4) 25 Potassium efflux system KefA protein Small-conductance mechanosensitive channel 13 Cobalt-zinc-cadmium resistance protein CzcA Cation efflux system protein CusA 13 Gamma-glutamyltranspeptidase (EC 2.3.2.2) Glutathione hydrolase (EC 3.4.19.13) 13 Efflux ABC transporter, ATP-binding protein Efflux ABC transporter, permease protein 11
Note that the occurrence counts are shown in the last column of the output.
Extract the Genomes in a List that have GC Content Values Greater Than a Certain Percentage
For this exercise we will use the genomes.tbl file as input and look for a GC content over 60%.
genome_id 1310696.14 66976.17 91890.5 316273.25 186497.12 1353158.3 135461.13 1173954.3 1176728.3
The GC content percentage is found in the gc_content attribute, as shown in the example below (we use p3-sort to sort the results by the content percentage).
p3-get-genome-data --attr gc_content --attr genome_name <genomes.tbl | p3-sort gc_content/ngenome_id genome.gc_content genome.genome_name 91890.5 38.19 Legionella pneumophila subsp. pascullei strain D-7158 66976.17 38.28 Legionella pneumophila serogroup 1 strain Lp01_666 186497.12 40.8 Pyrococcus furiosus DSM 3638 1353158.3 43.41 Methanococcoides vulcani strain SLH 33 135461.13 43.88 Bacillus subtilis subsp. subtilis strain BSD-2 1173954.3 45.1 Vibrio parahaemolyticus O4:K12 str. K1203 1176728.3 50.67 Escherichia coli K71 316273.25 64.56 Xanthomonas campestris pv. vesicatoria str. 85-10
As you can see, there is only one genome in this set with a GC
content over 60%. To get only that genome, we use the --gt
parameter to filter for specific values of that field.
p3-get-genome-data --attr gc_content --attr genome_name --gt gc_content,60 <genomes.tblgenome_id genome.gc_content genome.genome_name 316273.25 64.56 Xanthomonas campestris pv. vesicatoria str. 85-10
Compute how Close Two Features are on the Chromosome
We will ask this question for features fig|1302.21.peg.966 and fig|1302.21.peg.1019.
The script p3-feature-gap gives us this information. Since it expects two feature IDs on the same input line, we use a p3-echo with two titles to put its two parameters on a single line.
- ::
p3-echo -t f1.patric_id -t f2.patric_id “fig|1302.21.peg.966” “fig|1302.21.peg.1019” | p3-feature-gap
f1.patric_id f2.patric_id gap fig|1302.21.peg.966 fig|1302.21.peg.1019 55253
Note that if the features are on different contigs, we get a very high number.
p3-echo -t f1.patric_id -t f2.patric_id "fig|1313.7001.peg.1159" "fig|1313.7001.peg.1384" | p3-feature-gapf1.patric_id f2.patric_id gap fig|1313.7001.peg.1159 fig|1313.7001.peg.1384 2000000000
The very high number makes it easier to simply compare the distance outputs from p3-feature-gap. Features on different contigs will always sort as further apart than features on the same contig.
List the Drugs to which a Genome is Resistant
The drug name is in the antibiotic attribute of the genome-drug table. We start with a genome ID and use p3-get-genome-drugs. Our example is genome 46170.310 (Staphylococcus aureus subsp. aureus strain VB4283.
p3-echo -t genome_id 46170.310 | p3-get-genome-drugs --resistant --attr antibioticgenome_id genome_drug.antibiotic 46170.310 ciprofloxacin 46170.310 erythromycin 46170.310 gentamicin 46170.310 methicillin 46170.310 penicillin 46170.310 trimethoprim/sulfamethoxazole
Working with Anti-Microbial Drugs
Find Genomes that are Resistant to a Particular Drug
Here we start with a drug name (our example is erythromycin) and use p3-get-drug-genomes to get the genome data.
p3-echo -t antibiotic erythromycin | p3-get-drug-genomes --resistant --attr genome_id --attr genome_nameantibiotic genome_drug.genome_id genome_drug.genome_name erythromycin 1280.4920 Staphylococcus aureus P210110-35 erythromycin 1280.4930 Staphylococcus aureus P210184-226 erythromycin 1280.4940 Staphylococcus aureus P210369-10 erythromycin 1280.4960 Staphylococcus aureus P210464-28 erythromycin 1280.4970 Staphylococcus aureus P310372-198 erythromycin 1280.4990 Staphylococcus aureus P311202-207 erythromycin 1313.6942 Streptococcus pneumoniae P110340-157 erythromycin 1313.7001 Streptococcus pneumoniae P210774-233 erythromycin 1313.7002 Streptococcus pneumoniae P210824-213 erythromycin 1313.7006 Streptococcus pneumoniae P310010-154 erythromycin 1313.7013 Streptococcus pneumoniae P310795-191
Working with Protein Families
Compute the Average Length of Proteins in A Particular Family
If we had a file of protein family names with the amino acid length of each protein in the family, we can use the script p3-stats to output the mean length as well as the minimum, count, maximum, and standard deviation. The following pipe does the trick, using global family PGF_00112374 as an example.
p3-echo -t family PGF_00112374 | p3-get-family-features --ftype=global --attr aa_length | p3-stats --col=family feature.aa_lengthfamily count average min max stdev PGF_00112374 3414 818.125659050967 31 901 193.491091039707
The p3-echo command creates a one-line file with the family ID
in it. We use p3-get-family-features to get all the features in
this family. The --ftype=global parameter indicates that this is
a global protein family (there are also families of type local and
figfam). For each feature, we want the amino acid length. This
value is stored in the aa_length attribute. Finally, we have
p3-stats. The --col=family parameter tells us the input file
records are to be grouped by the content of the family column. The
positional feature.aa_length parameter tells us the numbers to
analyze can be found in the aa_length column from the feature
record. The output tells us there are 3414 pegs in the family. The
average length is a little over 818 amino acids with a standard
deviation of well over 193. The total range is 31 amino acids to 901
amino acids.
List the Genome and Feature ID for Each Feature in a Protein Family
The following pipe does the trick, using global family PGF_00112374 as an example.
p3-echo -t family PGF_00112374 | p3-get-family-features --ftype=global --attr genome_id,genome_name,patric_idfamily feature.genome_id feature.genome_name feature.patric_id PGF_00112374 1311.851 Streptococcus agalactiae strain AB-22 fig|1311.851.peg.1591 PGF_00112374 1311.879 Streptococcus agalactiae strain BE-PW-162 fig|1311.879.peg.755 PGF_00112374 1311.871 Streptococcus agalactiae strain CZ-NI-016 fig|1311.871.peg.1197 PGF_00112374 1311.841 Streptococcus agalactiae strain AB-11 fig|1311.841.peg.728 PGF_00112374 1311.903 Streptococcus agalactiae strain ES-PW-083 fig|1311.903.peg.1321 PGF_00112374 1311.908 Streptococcus agalactiae strain GB-PW-024 fig|1311.908.peg.1397 PGF_00112374 1311.960 Streptococcus agalactiae strain DE-PW-196 fig|1311.960.peg.1275 PGF_00112374 1311.964 Streptococcus agalactiae strain IT-PW-086 fig|1311.964.peg.1518 PGF_00112374 1311.965 Streptococcus agalactiae strain IT-PW-097 fig|1311.965.peg.1342 PGF_00112374 1311.860 Streptococcus agalactiae strain AB-70 fig|1311.860.peg.746
Working with Features
Find the Global Protein Family Containing a Particular Feature
For fig|446170.310.peg.738:
p3-echo -t patric_id "fig|46170.310.peg.738" | p3-get-feature-data --attr pgfam_id
There are a couple of important things here. We use the pgfam_id field to get the global protein family (plfam_id would be used to get the local protein family). Also, the feature ID is enclosed in double quotes on the command line so that the vertical bar doesn’t confuse the command-line shell.
patric_id feature.pgfam_id fig|46170.310.peg.738 PGF_00040464
Find the Function a Particular Feature implements
The function is stored in the feature table’s product attribute. We will use fig|46160.310.peg.738 as an example.
p3-echo -t patric_id "fig|46170.310.peg.738" | p3-get-feature-data --attr productpatric_id feature.product fig|46170.310.peg.738 Putative cysteine desulfurase, associated with tRNA 4-thiouridine synthase
Of course, you could ask this question of several features with a single pipe.
p3-echo -t patric_id "fig|46170.310.peg.738" "fig|1313.7001.peg.1189" "fig|66976.18.peg.131" | p3-get-feature-data --attr productpatric_id feature.product fig|46170.310.peg.738 Putative cysteine desulfurase, associated with tRNA 4-thiouridine synthase fig|1313.7001.peg.1189 IMP cyclohydrolase (EC 3.5.4.10) / Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) fig|66976.18.peg.131 hypothetical protein
The p3-echo command uses the --title command-line option to
determine how many parameters to put on each output line. Since our
example has only one title, the output file has only a single
column, and it can be easily piped to p3-get-feature-data.
Find a Feature from an Alternate Feature ID
Features in MAAGE are stored with four alternate IDs, all of which are indexed for fast retrieval.
gene. The common gene name (e.g.
ciaR). Not all features will have a common gene IDgene_id. The gene number
refseq_locus_tag. The locus tag from REFSEQ
The command p3-find-features is used to retrieve features based
on an alternate ID. The alternate IDs are piped in through the
standard input. Note that in some cases (e.g. the field gene),
there may be a lot of features with the same ID. The following pipes
return the ID and functional assignment using alternate IDs.
p3-echo coaA | p3-find-features --attr patric_id,product gene
id feature.patric_id feature.product
coaA fig|996634.5.peg.916 Pantothenate kinase (EC 2.7.1.33)
coaA fig|944560.4.peg.377 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992133.3.peg.4201 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992141.3.peg.4166 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992132.3.peg.4176 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992136.3.peg.3951 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992139.3.peg.4173 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992131.3.peg.3905 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992142.3.peg.3915 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992137.3.peg.4122 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992135.3.peg.3895 Pantothenate kinase (EC 2.7.1.33)
coaA fig|99287.12.peg.4355 Pantothenate kinase (EC 2.7.1.33)
coaA fig|996306.3.peg.645 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992175.3.peg.3998 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992179.3.peg.3888 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992177.3.peg.4127 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992178.3.peg.4122 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992180.3.peg.4094 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992172.3.peg.3873 Pantothenate kinase (EC 2.7.1.33)
coaA fig|992181.3.peg.3864 Pantothenate kinase (EC 2.7.1.33)
p3-echo 1029377 | p3-find-features --attr patric_id,product gene_id
id feature.patric_id feature.product
1029377 fig|210007.7.peg.1009 Pantothenate kinase (EC 2.7.1.33)
id feature.patric_id feature.product
24379558 fig|210007.7.peg.1009 Pantothenate kinase (EC 2.7.1.33)
p3-echo SMU.1126 | p3-find-features --attr patric_id,product refseq_locus_tag
id feature.patric_id feature.product
SMU.1126 fig|210007.7.peg.1009 Pantothenate kinase (EC 2.7.1.33)
Given a Feature ID, Find the Amino Acid Sequence
The amino acid sequence is in the attribute aa_sequence. You use p3-get-feature-data to access it.
p3-echo "fig|210007.7.peg.1009" | p3-get-feature-data --attr aa_sequence
id feature.aa_sequence
fig|210007.7.peg.1009 MANEFINFEKISRKTWQHLHQESQPPLNENELNSIKSLNDRISIKDVTDIYLPLISLIQIYKKSQENLSFSKSIFLQKNISNRPFIIGVSGSVAVGKSTTSRLLQLLLARTFKDSSVELMTTDGFLYPNAVLSSRHMLNKKGFPESYDMERLLDFLDTIKNGQSAEIPVYSHEIYDIVPNKSQIIEVPDFLIIEGINVFQNPQNNRLYMSDFFDFSIYIDADSDYIENWYLERFATLLDLAKNDKQNYYNRFLKLGEKGALDFARDIWKDINLVNLEKYIEPTRSRAELILHKTKNHKIDEIYLKK
Find How many Genomes have an Identical Protein to a Given Feature
The individual protein sequences are not indexed, but the MAAGE database contains an MD5 signature for each protein that is indexed, in the feature attribute aa_sequence_md5. The following pipe finds out how many times the protein sequence for fig|210007.7.peg.1009 occurs in the database.
p3-echo "fig|210007.7.peg.1009" | p3-get-feature-data --attr aa_sequence_md5 | p3-find-features aa_sequence_md5 --count
id feature.aa_sequence_md5 feature.count
fig|210007.7.peg.1009 6400069a6f7f32515c3a584ade0588d0 150
The answer is 150, but that is not quite the question that was asked. If the protein occurs more than once in a genome, then the above count will be too high. To get the correct answer we need to extract genome IDs and then count the number of distinct ones with p3-count.
p3-echo "fig|210007.7.peg.1009" | p3-get-feature-data --attr aa_sequence_md5 | p3-find-features aa_sequence_md5 --attr genome_id | p3-count genome_id
count
149
Given a Feature ID, Find the Features in the Same Protein Family
The family ID is in the pgfam_id attribute, and we use
p3-get-family-features with the --ftype=global to find the
other features.
p3-echo "fig|210007.7.peg.1009" | p3-get-feature-data --attr pgfam_id | p3-get-family-features --ne "patric_id,fig|210007.7" --ftype global --attr patric_id,genome_name,product
Note that we use the --ne operator to keep the original feature
from appearing in the output. Even so, the resulting file has over
67,000 results, the first few of which are shown below.
id feature.pgfam_id feature.patric_id feature.genome_name feature.product
fig|210007.7.peg.1009 PGF_00029921 fig|1341640.3.peg.2368 Yersinia sp. WP-930601 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|1341642.3.peg.3368 Yersinia sp. WP-931205 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|1344012.3.peg.2066 Tatumella sp. NML 06-3099 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|984229.3.peg.2006 Salmonella enterica subsp. enterica serovar Enteritidis str. 653049 13-19 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|984228.3.peg.4305 Salmonella enterica subsp. enterica serovar Enteritidis str. 648905 5-18 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|984226.3.peg.4289 Salmonella enterica subsp. enterica serovar Enteritidis str. 648903 1-6 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|984227.3.peg.3102 Salmonella enterica subsp. enterica serovar Enteritidis str. 648904 3-6 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|984224.3.peg.642 Salmonella enterica subsp. enterica serovar Enteritidis str. 648901 39-2 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PGF_00029921 fig|984225.3.peg.4221 Salmonella enterica subsp. enterica serovar Enteritidis str. 648902 6-8 Pantothenate kinase (EC 2.7.1.33)
Alternatively, you can use local protein families (plfam_id for
the field name, and --ftype=local for the family type). This
will restrict the output to features for genomes in the same genus.
p3-echo "fig|210007.7.peg.1009" | p3-get-feature-data --attr plfam_id | p3-get-family-features --ne "patric_id,fig|210007.7" --ftype local --attr patric_id,genome_name,product
id feature.plfam_id feature.patric_id feature.genome_name feature.product
fig|210007.7.peg.1009 PLF_1301_00006228 fig|1579339.3.peg.1420 Streptococcus sp. 449_SSPC Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|511691.3.peg.905 Streptococcus mutans NN2025 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|1404260.3.peg.1014 Streptococcus mutans PKUSS-LG01 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|1403829.3.peg.1035 Streptococcus mutans PKUSS-HG01 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857136.3.peg.247 Streptococcus mutans A19 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857135.3.peg.392 Streptococcus mutans U138 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857134.3.peg.201 Streptococcus mutans G123 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857133.3.peg.623 Streptococcus mutans M21 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857132.3.peg.561 Streptococcus mutans T4 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857138.3.peg.734 Streptococcus mutans N29 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|857137.3.peg.82 Streptococcus mutans NMT4863 Pantothenate kinase (EC 2.7.1.33)
fig|210007.7.peg.1009 PLF_1301_00006228 fig|1313.8640.peg.2062 Streptococcus pneumoniae strain B16827 Pantothenate kinase (EC 2.7.1.33)